PDB entry 4nc5

View 4nc5 on RCSB PDB site
Description: Human sialidase 2 in complex with 2,3-difluorosialic acid (covalent intermediate)
Class: hydrolase
Keywords: Human neuraminidase, sialidase, HYDROLASE
Deposited on 2013-10-24, released 2013-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.178
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialidase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NEU2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3R4
      • engineered mutation (169)
    Domains in SCOPe 2.03: d4nc5a_
  • Heterogens: FSI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nc5A (A:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkaehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nc5A (A:)
    slpvlqkesvfqsgahayripallylpgqqsllafaeqraaelivlrrgdydapthqvqw
    qaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvranvtrlcqvtstdhgrtw
    ssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiqrpipsafc
    flshdhgrtwarghfvaqdtlecqvaevetqrvvtlnarshlrarvqaqstndgldfqes
    qlvkklvepppqgcqgsvisfpspraqwllythpthswqradlgaylnprppapeawsep
    vllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaeyl