PDB entry 4nc2

View 4nc2 on RCSB PDB site
Description: Crystal structure of TcdB-B1 bound to B39 VHH
Class: immune system
Keywords: Antibody-antigen complex, IMMUNE SYSTEM
Deposited on 2013-10-23, released 2013-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin b
    Species: CLOSTRIDIUM DIFFICILE [TaxId:1496]
    Gene: tcdB, toxB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18177 (7-End)
      • expression tag (4-6)
  • Chain 'B':
    Compound: b39 vhh
    Species: Lama glama [TaxId:9844]
    Gene: VHH
    Database cross-references and differences (RAF-indexed):
    • PDB 4NC2 (0-End)
    Domains in SCOPe 2.05: d4nc2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nc2B (B:)
    qvqlvesggglvqaggslrlscaasgltfsryvmgwfrqapgkerefvaaitwggtpnya
    dsvkgrftisrdnskntqylqmnslkpedtavyycaaglgwdsrysqsynywgqgtqvtv
    ssgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nc2B (B:)
    qvqlvesggglvqaggslrlscaasgltfsryvmgwfrqapgkerefvaaitwggtpnya
    dsvkgrftisrdnskntqylqmnslkpedtavyycaaglgwdsrysqsynywgqgtqvtv
    ss