PDB entry 4naw

View 4naw on RCSB PDB site
Description: Crystal Structure of Human ATG12~ATG5-ATG16N in complex with a fragment of ATG3
Class: protein transport/ligase
Keywords: protein-protein conjugate, ubiquitin-like protein, autophagy, E3 ligase, PROTEIN TRANSPORT-LIGASE complex
Deposited on 2013-10-22, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein ATG12
    Species: Homo sapiens [TaxId:9606]
    Gene: APG12, APG12L, ATG12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nawa_
  • Chain 'B':
    Compound: Autophagy protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: APG5L, ASP, ATG5
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Autophagy-related protein 16-1
    Species: Homo sapiens [TaxId:9606]
    Gene: APG16L, ATG16L1, UNQ9393/PRO34307
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q676U5 (3-35)
      • expression tag (2)
  • Chain 'D':
    Compound: Ubiquitin-like-conjugating enzyme ATG3
    Species: Homo sapiens [TaxId:9606]
    Gene: APG3, APG3L, ATG3
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ubiquitin-like protein ATG12
    Species: Homo sapiens [TaxId:9606]
    Gene: APG12, APG12L, ATG12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nawe_
  • Chain 'F':
    Compound: Autophagy protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: APG5L, ASP, ATG5
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Autophagy-related protein 16-1
    Species: Homo sapiens [TaxId:9606]
    Gene: APG16L, ATG16L1, UNQ9393/PRO34307
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q676U5 (3-35)
      • expression tag (2)
  • Chain 'H':
    Compound: Ubiquitin-like-conjugating enzyme ATG3
    Species: Homo sapiens [TaxId:9606]
    Gene: APG3, APG3L, ATG3
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Ubiquitin-like protein ATG12
    Species: Homo sapiens [TaxId:9606]
    Gene: APG12, APG12L, ATG12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nawi_
  • Chain 'J':
    Compound: Autophagy protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: APG5L, ASP, ATG5
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Autophagy-related protein 16-1
    Species: Homo sapiens [TaxId:9606]
    Gene: APG16L, ATG16L1, UNQ9393/PRO34307
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q676U5 (3-35)
      • expression tag (2)
  • Chain 'L':
    Compound: Ubiquitin-like-conjugating enzyme ATG3
    Species: Homo sapiens [TaxId:9606]
    Gene: APG3, APG3L, ATG3
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Ubiquitin-like protein ATG12
    Species: Homo sapiens [TaxId:9606]
    Gene: APG12, APG12L, ATG12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nawm_
  • Chain 'N':
    Compound: Autophagy protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: APG5L, ASP, ATG5
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Autophagy-related protein 16-1
    Species: Homo sapiens [TaxId:9606]
    Gene: APG16L, ATG16L1, UNQ9393/PRO34307
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q676U5 (3-35)
      • expression tag (2)
  • Chain 'P':
    Compound: Ubiquitin-like-conjugating enzyme ATG3
    Species: Homo sapiens [TaxId:9606]
    Gene: APG3, APG3L, ATG3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nawA (A:)
    gskkkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfa
    pspdqevgtlyecfgsdgklvlhycksqawg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nawA (A:)
    kkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfapsp
    dqevgtlyecfgsdgklvlhycksqawg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nawE (E:)
    gskkkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfa
    pspdqevgtlyecfgsdgklvlhycksqawg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nawE (E:)
    kkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfapsp
    dqevgtlyecfgsdgklvlhycksqawg
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4nawI (I:)
    gskkkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfa
    pspdqevgtlyecfgsdgklvlhycksqawg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nawI (I:)
    kkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfapsp
    dqevgtlyecfgsdgklvlhycksqawg
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4nawM (M:)
    gskkkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfa
    pspdqevgtlyecfgsdgklvlhycksqawg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nawM (M:)
    kkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfapsp
    dqevgtlyecfgsdgklvlhycksqawg
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.