PDB entry 4n8p

View 4n8p on RCSB PDB site
Description: Crystal structure of a strand swapped CTLA-4 from Duckbill Platypus [PSI-NYSGRC-012711]
Class: immune system
Keywords: Immune system, ortholog, Ig V-type domain, Structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC
Deposited on 2013-10-17, released 2013-10-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Ornithorhynchus anatinus [TaxId:9258]
    Gene: CTLA-4, CTLA4
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6ZMI5 (8-End)
      • expression tag (2-7)
    Domains in SCOPe 2.03: d4n8pa_
  • Heterogens: GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4n8pA (A:)
qdyggppalqvtqprvvlasmkgvaslaceyeftgkakeirvtlirqtgnefhevcassf
tteyepfvstediechvqpsennvtltlmglkatdtglyvcrvelmypppyymglgngtq
iyvvepepaenlyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >4n8pA (A:)
yggppalqvtqprvvlasmkgvaslaceyeftgkakeirvtlirqtgnefhevcassftt
eyepfdiechvqpsennvtltlmglkatdtglyvcrvelmypppyymglgngtqiyvve