PDB entry 4n8d

View 4n8d on RCSB PDB site
Description: DPP4 complexed with syn-7aa
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-10-17, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (Start-727)
      • conflict (398)
    Domains in SCOPe 2.06: d4n8da1, d4n8da2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (Start-727)
      • conflict (398)
      • expression tag (728-733)
    Domains in SCOPe 2.06: d4n8db1, d4n8db2, d4n8db3
  • Heterogens: NAG, SO4, 2KS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n8dA (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlidytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslpaaaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n8dA (A:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlidytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n8dB (B:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlidytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslpaaaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n8dB (B:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlidytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslpaaasws