PDB entry 4n6e

View 4n6e on RCSB PDB site
Description: Crystal structure of Amycolatopsis orientalis BexX/CysO complex
Class: Lyase/BIOSYNTHETIC PROTEIN
Keywords: Alpha beta barrel, protein-protein complex, BexX, thiosugar synthase, CysO, sulfur carrier protein, Lyase-BIOSYNTHETIC PROTEIN complex
Deposited on 2013-10-11, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative thiosugar synthase
    Species: Amycolatopsis orientalis [TaxId:797057]
    Gene: bexX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n6ea_
  • Chain 'B':
    Compound: ThiS/MoaD family protein
    Species: Amycolatopsis orientalis [TaxId:1156913]
    Gene: AORI_6493
    Database cross-references and differences (RAF-indexed):
    • PDB 4N6E (Start-89)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n6eA (A:)
    mtiphigvvadepwlkigarefrsrilvgieqydsvplvrdvlnaagadvfittvdpdnr
    rsslllmdladelplddftwigttsfartkesalrsarilrdslgieilkldvrgddntp
    dnagtveaarelraegmellpfilpdlataraleeagcaalrvmaspvasgrgianpaai
    relieqigipvvveggigsarhvaeamelgasatlvntalvraespllmaaamrqaalag
    llsyesgpmpevaaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6eA (A:)
    depwlkigarefrsrilvgieqydsvplvrdvlnaagadvfittvdpdnrrsslllmdla
    delplddftwigttsfartkesalrsarilrdslgieilkldvrgddntpdnagtveaar
    elraegmellpfilpdlataraleeagcaalrvmaspvasgrgianpaairelieqigip
    vvveggigsarhvaeamelgasatlvntalvraespllmaaamrqaalagllsyesgpmp
    evaa
    

  • Chain 'B':
    No sequence available.