PDB entry 4n68

View 4n68 on RCSB PDB site
Description: Crystal structure of an internal FN3 domain from human Contactin-5 [PSI-NYSGRC-005804]
Class: cell adhesion
Keywords: internal FN3 domain, cell adhesion, Structural genomics, PSI-biology, New York Structural Genomics Research Consortium, NYSGRC
Deposited on 2013-10-11, released 2013-10-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Contactin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: CNTN5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94779 (Start-105)
      • expression tag (106)
    Domains in SCOPe 2.05: d4n68a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4n68A (A:)
qdyggaegepsaaptdvkatsvsvseilvawkhikeslgrpqgfevgywkdmeqedtaet
vktrgnesfviltglegntlyhftvrayngagygppssevsattkkaenlyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >4n68A (A:)
epsaaptdvkatsvsvseilvawkhikeslgrpqgfevgywkdmeqedtaetvktrgnes
fviltglegntlyhftvrayngagygppssevsattkka