PDB entry 4n5u

View 4n5u on RCSB PDB site
Description: Crystal structure of the 4th FN3 domain of human Protein Tyrosine phosphatase, receptor type F [PSI-NYSGRC-006240]
Class: hydrolase
Keywords: internal FN3 domain, Structural genomics, PSI-Biology, New York Structural Genomics Research Consortium (NYSGRC), HYDROLASE
Deposited on 2013-10-10, released 2013-10-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.164
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Homo sapiens [TaxId:9606]
    Gene: LAR, PTPRF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10586 (Start-109)
      • expression tag (110-113)
    Domains in SCOPe 2.05: d4n5ua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4n5uA (A:)
qdyggtaqstpsappqkvmcvsmgsttvrvswvpppadsrngvitqysvayeavdgedrg
rhvvdgisrehsswdlvglekwteyrvwvrahtdvgpgpesspvlvrtdeaenlyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >4n5uA (A:)
aqstpsappqkvmcvsmgsttvrvswvpppadsrngvitqysvayeavdgedrgrhvvdg
isrehsswdlvglekwteyrvwvrahtdvgpgpesspvlvrtdeaenl