PDB entry 4n42

View 4n42 on RCSB PDB site
Description: Crystal structure of allergen protein scam1 from Scadoxus multiflorus
Class: hydrolase inhibitor
Keywords: Tim Barrel, HYDROLASE INHIBITOR
Deposited on 2013-10-08, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.155
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase and alpha-amylase inhibitor protein isoform III
    Species: Scadoxus multiflorus [TaxId:82246]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n42a_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4n42A (A:)
    gnldiavywgqnfdersleatcdsgnyayviigflntfgggqtpaldisghspsglepqi
    khcqsknvkvllsiggpagpysldsrsdandlavylfnnfllppghsennpfgnavldgi
    dfhiehggpsqyqllanilssfrlkgtefaltaapqcvypdpnlgtvinsatfdaiwvqf
    ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppakvkfhvfpa
    akksykfggimlwdsywdtvsqfsnkilgdgv