PDB entry 4n35

View 4n35 on RCSB PDB site
Description: Structure of langerin CRD I313 complexed with GlcNAc-beta1-3Gal-beta1-4Glc-beta-CH2CH2N3
Class: sugar binding protein
Keywords: CRD carbohydrate complex, carbohydrate-recognition domain, C-type lectin on Langerhans cells, Carbohydrate/Sugar Binding, receptor on Langerhans cells, SUGAR BINDING PROTEIN
Deposited on 2013-10-06, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • variant (85)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4n35a_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • variant (85)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4n35b_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • variant (85)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4n35c_
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • variant (85)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4n35d_
  • Heterogens: NAG, GAL, BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n35A (A:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    itflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n35A (A:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcditflf
    ickrpyvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n35B (B:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    itflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n35B (B:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcditflf
    ickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n35C (C:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    itflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n35C (C:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
    tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcditf
    lfickrpyvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n35D (D:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    itflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n35D (D:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcditfl
    fickrpyv