PDB entry 4n1y

View 4n1y on RCSB PDB site
Description: Crystal Structure of the Pacific Oyster Estrogen Receptor Ligand Binding Domain
Class: transcription
Keywords: estrogen, Nuclear Hormone Receptor, Endocrine signaling, TRANSCRIPTION
Deposited on 2013-10-04, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: CGI_10024100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n1ya_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: CGI_10024100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n1yb_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: CGI_10024100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n1yc_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Crassostrea gigas [TaxId:29159]
    Gene: CGI_10024100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n1yd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n1yA (A:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n1yA (A:)
    qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
    slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
    vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
    rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n1yB (B:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n1yB (B:)
    qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
    slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
    vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
    rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n1yC (C:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n1yC (C:)
    tvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdls
    lsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaav
    seqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnvr
    hvpavllllthirqagergiaffqrlksegvvtfcdllkemlda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n1yD (D:)
    snaksqtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvp
    gytdlslsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteif
    eqvaavseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqky
    hpdnvrhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqdflekkssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n1yD (D:)
    qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
    slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
    vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
    rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaq