PDB entry 4n0k
View 4n0k on RCSB PDB site
Description: Atomic resolution crystal structure of a cytochrome c-calixarene complex
Class: electron transport
Keywords: all alpha, electron carrier protein, electron transport, mitochondrion
Deposited on
2013-10-02, released
2014-09-10
The last revision prior to the SCOPe 2.04 freeze date was dated
2014-09-10, with a file datestamp of
2014-09-05.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.158
AEROSPACI score: 0.86
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: CYC1, J1653, YJR048W
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (0-105)
- engineered mutation (17)
- expression tag (106-107)
Domains in SCOPe 2.04: d4n0ka_ - Chain 'B':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: CYC1, J1653, YJR048W
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (0-105)
- engineered mutation (17)
- expression tag (106-107)
Domains in SCOPe 2.04: d4n0kb_ - Heterogens: HEM, T3Y, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4n0kA (A:)
tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4n0kB (B:)
tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate