PDB entry 4mze

View 4mze on RCSB PDB site
Description: Crystal structure of hPIV3 hemagglutinin-neuraminidase, H552Q/Q559R mutant
Class: hydrolase
Keywords: viral envelope protein, viral fusion protein, HYDROLASE
Deposited on 2013-09-30, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza 3 virus [TaxId:11217]
    Gene: HN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08492 (Start-436)
      • engineered mutation (416)
      • engineered mutation (423)
    Domains in SCOPe 2.07: d4mzea_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza 3 virus [TaxId:11217]
    Gene: HN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08492 (Start-436)
      • engineered mutation (416)
      • engineered mutation (423)
    Domains in SCOPe 2.07: d4mzeb_
  • Heterogens: NAG, BMA, MAN, FUL, PO4, CA, EDO, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mzeA (A:)
    evppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtps
    lvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrks
    cslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpy
    aalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdr
    rmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlg
    iiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvi
    ldsqksrvnpvityststervnelairnktlsagytttscithynkgycfhiveinqksl
    dtfrpmlfkteipkscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzeA (A:)
    rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
    liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
    lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
    svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
    iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
    dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
    srvnpvityststervnelairnktlsagytttscithynkgycfhiveinqksldtfrp
    mlfkteipkscs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mzeB (B:)
    evppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtps
    lvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrks
    cslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpy
    aalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdr
    rmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlg
    iiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvi
    ldsqksrvnpvityststervnelairnktlsagytttscithynkgycfhiveinqksl
    dtfrpmlfkteipkscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzeB (B:)
    rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
    liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
    lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
    svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
    iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
    dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
    srvnpvityststervnelairnktlsagytttscithynkgycfhiveinqksldtfrp
    mlfkteipkscs