PDB entry 4mza

View 4mza on RCSB PDB site
Description: Crystal structure of hPIV3 hemagglutinin-neuraminidase
Class: hydrolase
Keywords: viral envelope protein, viral fusion protein, HYDROLASE
Deposited on 2013-09-29, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza 3 virus [TaxId:11217]
    Gene: HN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mzaa_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza 3 virus [TaxId:11217]
    Gene: HN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mzab_
  • Heterogens: NAG, BMA, MAN, CA, EDO, SO4, FUL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mzaA (A:)
    evppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtps
    lvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrks
    cslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpy
    aalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdr
    rmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlg
    iiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvi
    ldsqksrvnpvityststervnelairnktlsagytttscithynkgycfhiveinhksl
    dtfqpmlfkteipkscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzaA (A:)
    rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
    liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
    lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
    svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
    iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
    dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
    srvnpvityststervnelairnktlsagytttscithynkgycfhiveinhksldtfqp
    mlfkteipkscs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mzaB (B:)
    evppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtps
    lvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrks
    cslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpy
    aalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdr
    rmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlg
    iiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvi
    ldsqksrvnpvityststervnelairnktlsagytttscithynkgycfhiveinhksl
    dtfqpmlfkteipkscs