PDB entry 4myo

View 4myo on RCSB PDB site
Description: Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus
Class: transferase
Keywords: structural genomics, antibiotic resistance, center for structural genomics of infectious diseases, csgid, niaid, national institute of allergy and infectious diseases, left-handed beta helix domain, xenobiotic acyltransferase (xat) family, hexapeptide repeat acyltransferase, transferase, streptogramin group a antibiotics, streptogramin a, virginiamycin, dalfopristin, acetyl coenzyme a, coenzyme a, intracellular
Deposited on 2013-09-27, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26839 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4myoa1, d4myoa2
  • Chain 'B':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26839 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4myob1, d4myob2
  • Chain 'C':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4myoc_
  • Heterogens: MG, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4myoA (A:)
    ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4myoA (A:)
    ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4myoB (B:)
    ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4myoB (B:)
    ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrklld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4myoC (C:)
    ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4myoC (C:)
    hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
    iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
    igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
    wnldmkiinenlpfiingdiemlkrkrklld