PDB entry 4myl

View 4myl on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi Formiminoglutamase (oxidized) at pH 4.6
Class: hydrolase
Keywords: arginase/deacetylase (a/b) fold, Hydrolase
Deposited on 2013-09-27, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.136
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formiminoglutamase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DSA0
      • engineered mutation (309)
    Domains in SCOPe 2.07: d4myla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mylA (A:)
    mahhhhhhmaartddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafr
    fflqrlgsvnnlelnvdashlklydagditastleeahekleskvftvlargafpfvigg
    gndqsapngramlrafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrf
    vefacqgsqcgalhaqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdsl
    kssdmpgvscpaavglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfy
    hfvlgfatrpkpkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mylA (A:)
    ddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnle
    lnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngraml
    rafpgdvgvinvdshldvrpptpfrqlleessfsgkrfvefacqgsqcgalhaqyvrdhq
    ghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpaavglsaqeaf
    dmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp