PDB entry 4myf

View 4myf on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi formiminoglutamase(oxidized) with Mn2+2 at pH 6.0
Class: hydrolase
Keywords: Arginase/deacetylase (a/b) fold, Hydrolase
Deposited on 2013-09-27, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formiminoglutamase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DSA0
      • engineered mutation (309)
    Domains in SCOPe 2.07: d4myfa_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4myfA (A:)
    mahhhhhhmaartddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafr
    fflqrlgsvnnlelnvdashlklydagditastleeahekleskvftvlargafpfvigg
    gndqsapngramlrafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrf
    vefacqgsqcgalhaqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdsl
    kssdmpgvscpaavglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfy
    hfvlgfatrpkpkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4myfA (A:)
    tddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnl
    elnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngram
    lrafpgdvgvinvdshldvrpgtpfrqlleessfsgkrfvefacqgsqcgalhaqyvrdh
    qghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpaavglsaqea
    fdmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp