PDB entry 4mye

View 4mye on RCSB PDB site
Description: Cymosema roseum seed lectin structure complexed with X-man
Class: Carbohydrate-binding protein
Keywords: Jelly roll, Lectin, Carbohydrate-binding protein
Deposited on 2013-09-27, released 2014-10-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cymbosema roseum mannose-specific lectin
    Species: Cymbosema roseum [TaxId:202239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4myea_
  • Heterogens: MN, CA, XMM, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4myeA (A:)
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktnsi
adanalhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvh
iwessavvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan