PDB entry 4my6

View 4my6 on RCSB PDB site
Description: EnaH-EVH1 domain in complex with non-peptidic low-molecular weight competitor
Class: Cell adhesion/inhibitor
Keywords: MOLECULAR RECOGNITION, ACTIN DYNAMICS, Cell adhesion-inhibitor complex
Deposited on 2013-09-27, released 2014-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ENAH, MENA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ENAH, MENA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N8S7 (2-112)
      • expression tag (1)
    Domains in SCOPe 2.04: d4my6b_
  • Heterogens: 3VH, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4my6B (B:)
    gsmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqv
    vincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4my6B (B:)
    smseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl