PDB entry 4mxx

View 4mxx on RCSB PDB site
Description: Human Src A403T mutant bound to kinase inhibitor bosutinib
Class: transferase/transferase inhibitor
Keywords: Kinase, Phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-09-26, released 2013-12-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-285)
      • engineered mutation (155)
    Domains in SCOPe 2.03: d4mxxa_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-285)
      • engineered mutation (155)
    Domains in SCOPe 2.03: d4mxxb_
  • Heterogens: DB8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mxxA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvtdfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mxxA (A:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
    lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
    vermnyvhrdlraanilvgenlvckvtdfglarliefpikwtapeaalygrftiksdvws
    fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerp
    tfeylqafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mxxB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvtdfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mxxB (B:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvtdfglfpikwtapeaalygrftiksdvwsfgillt
    elttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylq
    afledyftstepqyqpgenl