PDB entry 4mxr

View 4mxr on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi formiminoglutamase with Mn2+2
Class: hydrolase
Keywords: Arginase/deacetylase (a/b) fold, Hydrolase
Deposited on 2013-09-26, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formiminoglutamase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DSA0
      • engineered mutation (309)
    Domains in SCOPe 2.07: d4mxra_
  • Chain 'B':
    Compound: Formiminoglutamase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DSA0
      • engineered mutation (309)
    Domains in SCOPe 2.07: d4mxrb_
  • Heterogens: MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mxrA (A:)
    mahhhhhhmaartddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafr
    fflqrlgsvnnlelnvdashlklydagditastleeahekleskvftvlargafpfvigg
    gndqsapngramlrafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrf
    vefacqgsqcgalhaqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdsl
    kssdmpgvscpaavglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfy
    hfvlgfatrpkpkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mxrA (A:)
    ddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnle
    lnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngraml
    rafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrfvefacqgsqcgal
    haqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpaa
    vglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mxrB (B:)
    mahhhhhhmaartddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafr
    fflqrlgsvnnlelnvdashlklydagditastleeahekleskvftvlargafpfvigg
    gndqsapngramlrafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrf
    vefacqgsqcgalhaqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdsl
    kssdmpgvscpaavglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfy
    hfvlgfatrpkpkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mxrB (B:)
    ddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnle
    lnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngraml
    rafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrfvefacqgsqcgal
    haqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpaa
    vglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp