PDB entry 4mwf

View 4mwf on RCSB PDB site
Description: Structure of Hepatitis C Virus Envelope Glycoprotein E2 core bound to broadly neutralizing antibody AR3C
Class: immune system
Keywords: Immunoglobulin Fold, HCV E2, IMMUNE SYSTEM
Deposited on 2013-09-24, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab AR3C heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MWF
  • Chain 'B':
    Compound: Fab AR3C light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MWF
    Domains in SCOPe 2.07: d4mwfb1, d4mwfb2
  • Chain 'C':
    Compound: Envelope glycoprotein E2
    Species: Hepatitis C virus (isolate H) [TaxId:11108]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958
      • engineered mutation (36)
    • Uniprot P27958 (Start-211)
      • engineered mutation (142)
      • variant (168)
  • Chain 'D':
    Compound: Envelope glycoprotein E2
    Species: Hepatitis C virus (isolate H) [TaxId:11108]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958
      • engineered mutation (36)
    • Uniprot P27958 (Start-211)
      • variant (168)
  • Chain 'H':
    Compound: Fab AR3C heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MWF
  • Chain 'L':
    Compound: Fab AR3C light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MWF
    Domains in SCOPe 2.07: d4mwfl1, d4mwfl2
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mwfB (B:)
    eieltqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltvsrlepedsavyfcqqyyrspltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mwfB (B:)
    eltqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgiparf
    sgsgsgteftltvsrlepedsavyfcqqyyrspltfgggtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4mwfL (L:)
    eieltqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltvsrlepedsavyfcqqyyrspltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mwfL (L:)
    ieltqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipar
    fsgsgsgteftltvsrlepedsavyfcqqyyrspltfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge