PDB entry 4mv7

View 4mv7 on RCSB PDB site
Description: Crystal Structure of Biotin Carboxylase form Haemophilus influenzae in Complex with Phosphonoformate
Class: ligase
Keywords: ATP-grasp, LIGASE
Deposited on 2013-09-23, released 2015-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Haemophilus influenzae [TaxId:71421]
    Gene: accC, HI_0972
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mv7a1, d4mv7a2, d4mv7a3
  • Heterogens: PPF, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mv7A (A:)
    mgsshhhhhhssglvprgshmlekvvianrgeialrilrackelgiktvavhstadrdlk
    hvlladeticigpapsaksylnipaiiaaaevtgadaihpgygflsenadfaeqversgf
    tfigptadvirlmgdkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiika
    sgggggrgmrvvrsedaleesiamtkaeakaafnndmvymekylenprhveiqvladthg
    navylaerdcsmqrrhqkvveeapapgiteevrrdigsrcanacveigyrgagtfeflye
    ngefyfiemntriqvehpvtemitgvdlvkeqlriaaglpisfkqedikvkghamecrin
    aedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklitygdtrevair
    rmqnalsetiidgiktniplheliledenfqkggtnihylekklgmne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mv7A (A:)
    mlekvvianrgeialrilrackelgiktvavhstadrdlkhvlladeticigpapsaksy
    lnipaiiaaaevtgadaihpgygflsenadfaeqversgftfigptadvirlmgdkvsai
    kamkkagvpcvpgsaknkeiakrigypiiirvvrsedaleesiamtkaemekylenprhv
    eiqvladthgnavylaerdcsmqrrhqkvveeapapgiteevrrdigsrcanacveigyr
    gagtfeflyengefyfiemntriqvehpvtemitgvdlvkeqlriaaglpisfkqedikv
    kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit
    ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekkl