PDB entry 4mu3

View 4mu3 on RCSB PDB site
Description: The form A structure of an E21Q catalytic mutant of A. thaliana IGPD2 in complex with Mn2+ and a mixture of its substrate, 2R3S-IGP, and an inhibitor, 2S3S-IGP, to 1.12 A resolution
Class: lyase/lyase inhibitor
Keywords: hydro-lyase, histidine biosynthesis, manganese binding, chloroplastic, LYASE-LYASE INHIBITOR complex
Deposited on 2013-09-20, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O23346
      • engineered mutation (18)
    Domains in SCOPe 2.07: d4mu3a1, d4mu3a2
  • Heterogens: MN, IG2, IYP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mu3A (A:)
    maspiesarigevkretkqtnvsvkinldghgvsdsstgipfldhmldqlashglfdvhv
    ratgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrp
    ylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafara
    lrqatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mu3A (A:)
    sarigevkretkqtnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprrg