PDB entry 4mth

View 4mth on RCSB PDB site
Description: Crystal structure of mature human RegIIIalpha
Class: antimicrobial protein
Keywords: hip/pap, regiii-gamma, c-type lectin, antimicrobial protein
Deposited on 2013-09-19, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.187
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regenerating islet-derived protein 3-alpha 15 kDa form
  Species: Homo sapiens [TaxId:9606]
  Gene: HIP, PAP, PAP1, REG3A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q06141 (1-138)
    • initiating methionine (0)
  Domains in SCOPe 2.03: d4mtha_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4mthA (A:)
  mircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksig
  nsysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstafl
  rwkdyncnvrlpyvckftd