PDB entry 4mth

View 4mth on RCSB PDB site
Description: Crystal structure of mature human RegIIIalpha
Class: antimicrobial protein
Keywords: hip/pap, regiii-gamma, c-type lectin, antimicrobial protein
Deposited on 2013-09-19, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regenerating islet-derived protein 3-alpha 15 kDa form
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP, PAP, PAP1, REG3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06141 (1-138)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4mtha_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mthA (A:)
    mircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksig
    nsysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstafl
    rwkdyncnvrlpyvckftd