PDB entry 4mtd

View 4mtd on RCSB PDB site
Description: Zinc Uptake Regulator Complexed With Zinc AND DNA
Class: DNA binding protein/DNA
Keywords: Protein-DNA complex, winged-helix, DNA-BINDING REGULATORY PROTEIN, Helix-turn-helix, winged helix, Zinc regulated repressor, DNA binding, DNA BINDING PROTEIN-DNA complex
Deposited on 2013-09-19, released 2014-11-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc uptake regulation protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4046, JW5714, yjbK, zur
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mtda_
  • Chain 'B':
    Compound: Zinc uptake regulation protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4046, JW5714, yjbK, zur
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mtdb_
  • Chain 'C':
    Compound: Zinc uptake regulation protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4046, JW5714, yjbK, zur
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mtdc_
  • Chain 'D':
    Compound: Zinc uptake regulation protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4046, JW5714, yjbK, zur
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mtdd_
  • Chain 'Y':
    Compound: znuABC operator DNA
  • Chain 'Z':
    Compound: znuABC operator DNA
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mtdA (A:)
    mektttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakp
    ptvyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedi
    mhtlaakmgfalrhnvieahglcaacveveacrhpeqcqhdhsvqvkkkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mtdA (A:)
    tttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakpptv
    yraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedimht
    laakmgfalrhnvieahglcaacveveac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mtdB (B:)
    mektttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakp
    ptvyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedi
    mhtlaakmgfalrhnvieahglcaacveveacrhpeqcqhdhsvqvkkkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mtdB (B:)
    ktttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakppt
    vyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedimh
    tlaakmgfalrhnvieahglcaacveveac
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mtdC (C:)
    mektttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakp
    ptvyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedi
    mhtlaakmgfalrhnvieahglcaacveveacrhpeqcqhdhsvqvkkkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mtdC (C:)
    ttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakpptvy
    raldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedimhtl
    aakmgfalrhnvieahglcaacveveac
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mtdD (D:)
    mektttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakp
    ptvyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedi
    mhtlaakmgfalrhnvieahglcaacveveacrhpeqcqhdhsvqvkkkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mtdD (D:)
    ektttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakpp
    tvyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedim
    htlaakmgfalrhnvieahglcaacveveac
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.