PDB entry 4msv

View 4msv on RCSB PDB site
Description: Crystal structure of FASL and DcR3 complex
Class: immune system
Keywords: FASL, DCR3, TNF, TNFR, TNF6, STRUCTURAL GENOMICS, PSI-BIOLOGY, NEW YORK STRUCTURAL GENOMICS, RESEARCH CONSORTIUM, NYSGRC, IMMUNITY, TNF SUPE CD95L, FAS LIGAND, MEMBRANE, ATOMS-TO-ANIMALS: THE IMMUNE FUNCTION NETWORK, IFN, JELLY-ROLL FOLD, BIND TNF RECEPTOR FAS, Protein Structure Initiative, New York Structural Genomics Research Consortium, CD95L, TNF SUPERFAMILY, SECRETED PROTEIN, CYTOKINE, IMMUNE SYSTEM
Deposited on 2013-09-18, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FASLG, APT1LG1, CD95L, FASL, TNFSF6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4msva_
  • Chain 'B':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4msvA (A:)
    qighpspppekkelrkvahltgksnsrsmplewedtygivllsgvkykkgglvinetgly
    fvyskvyfrgqscnnlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgavf
    nltsadhlyvnvselslvnfeesqtffglykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4msvA (A:)
    lrkvahltgksnsrsmplewedtygivllsgvkykkgglvinetglyfvyskvyfrgqsc
    nnlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgavfnltsadhlyvnvs
    elslvnfeesqtffglykl
    

  • Chain 'B':
    No sequence available.