PDB entry 4ms8

View 4ms8 on RCSB PDB site
Description: 42F3 TCR pCPB9/H-2Ld Complex
Class: immune system
Keywords: Ig, TCR MHC, IMMUNE SYSTEM
Deposited on 2013-09-18, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (1-End)
      • expression tag (0)
      • engineered mutation (8)
      • engineered mutation (12)
      • engineered mutation (23)
      • engineered mutation (30)
      • engineered mutation (49)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d4ms8a1, d4ms8a2
  • Chain 'B':
    Compound: pCPB9
    Database cross-references and differences (RAF-indexed):
    • PDB 4MS8 (0-8)
  • Chain 'C':
    Compound: 42F3 alpha
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MS8
    Domains in SCOPe 2.07: d4ms8c1, d4ms8c2
  • Chain 'D':
    Compound: 42F3 beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MS8 (Start-242)
    Domains in SCOPe 2.07: d4ms8d1, d4ms8d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ms8A (A:)
    mgphsmryyetatsrrglgeprytsvgyvddkefvrfdsdaenpryepqvpwmeqegpey
    weritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfayd
    gcdyialnedlrtwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ms8A (A:)
    mgphsmryyetatsprytsvgyvddkefvrfdsdaenpryepqvpwmeqegpeyweritq
    iakgqeqwfrvnlrtllgyhtlqwmygcdvgsdgrllrgyeqfaydgcdyialnedlrtw
    taadmaaqitrrkweqagaaeyyraylegecvewlhrylkng
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ms8C (C:)
    gshmaqsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqmllkyysgdpv
    vqgvngfeaefsksdssfhlrkasvhwsdsavyfcavsakgtgsklsfgkgakltvspni
    qnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsa
    vawsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ms8C (C:)
    svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqmllkyysgdpvvqgvng
    feaefsksdssfhlrkasvhwsdsavyfcavsakgtgsklsfgkgakltvspniqnpdpa
    vyqlrdsksdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnkd
    facanafnsiipedtf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ms8D (D:)
    mgeaavtqsprnkvtvtggnvtlscrqtnshnymywyrqdtghglrlihysygagnlqig
    dvpdgykatrttqedfflllelaspsqtslyfcassdapgqlyfgegskltvledlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ms8D (D:)
    avtqsprnkvtvtggnvtlscrqtnshnymywyrqdtghglrlihysygagnlqigdvpd
    gykatrttqedfflllelaspsqtslyfcassdapgqlyfgegskltvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad