PDB entry 4mrq

View 4mrq on RCSB PDB site
Description: Crystal Structure of wild-type unphosphorylated PMM/PGM
Class: isomerase
Keywords: isomerase
Deposited on 2013-09-17, released 2014-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase/phosphoglucomutase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: algC, PA5322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mrqa1, d4mrqa2, d4mrqa3, d4mrqa4
  • Heterogens: ZN, TLA, EDO, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mrqA (A:)
    lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
    iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
    eqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngvagvia
    pqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgdgdrv
    gvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktgh
    slikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsafp
    sdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttpv
    lvlrfeadteeeleriktvfrnqlkavdsslpvpf