PDB entry 4mqb

View 4mqb on RCSB PDB site
Description: Crystal structure of thymidylate kinase from Staphylococcus aureus in complex with 2-(N-morpholino)ethanesulfonic acid
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, thymidylate kinase, TRANSFERASE
Deposited on 2013-09-16, released 2013-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.145
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mqba_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mqbb_
  • Heterogens: MES, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mqbA (A:)
    snamsafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndm
    dirteamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralne
    fainglypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqr
    fksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mqbA (A:)
    msafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdir
    teamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefai
    nglypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihsqrfksvn
    adqplenvvedtyqtiikyleki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mqbB (B:)
    snamsafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndm
    dirteamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralne
    fainglypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqr
    fksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mqbB (B:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
    nadqplenvvedtyqtiikylek