PDB entry 4mqb

View 4mqb on RCSB PDB site
Description: Crystal structure of thymidylate kinase from Staphylococcus aureus in complex with 2-(N-morpholino)ethanesulfonic acid
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, thymidylate kinase, TRANSFERASE, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors
Deposited on 2013-09-16, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mqba_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mqbb_
  • Heterogens: MES, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mqbA (A:)
    snamsafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndm
    dirteamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralne
    fainglypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqr
    fksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mqbA (A:)
    msafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdir
    teamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefai
    nglypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihsqrfksvn
    adqplenvvedtyqtiikyleki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mqbB (B:)
    snamsafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndm
    dirteamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralne
    fainglypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqr
    fksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mqbB (B:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
    nadqplenvvedtyqtiikylek