PDB entry 4mo3

View 4mo3 on RCSB PDB site
Description: Crystal Structure of Porcine C2 Domain of Blood Coagulation Factor VIII
Class: blood clotting
Keywords: Blood coagulation domain, BLOOD CLOTTING
Deposited on 2013-09-11, released 2013-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: coagulation factor viii
    Species: Sus scrofa [TaxId:9823]
    Gene: F8, CF8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mo3m_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4mo3M (M:)
    mgsshhhhhhenlyfqgsdlnscsmplgmqnkaisdsqitasshlsnifatwspsqarlh
    lqgrtnawrprvssaeewlqvdlqktvkvtgittqgvksllssmyvkeflvsssqdgrrw
    tlflqdghtkvfqgnqdsstpvvnaldpplftrylrihptswaqhialrlevlgcea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mo3M (M:)
    scsmplgmqnkaisdsqitasshlsnifatwspsqarlhlqgrtnawrprvssaeewlqv
    dlqktvkvtgittqgvksllssmyvkeflvsssqdgrrwtlflqdghtkvfqgnqdsstp
    vvnaldpplftrylrihptswaqhialrlevlgcea