PDB entry 4mns

View 4mns on RCSB PDB site
Description: Crystal structure of the major pollen allergen Bet v 1-A in complex with P303
Class: allergen
Keywords: Major pollen allergen, ALLERGEN
Deposited on 2013-09-11, released 2015-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mnsa_
  • Heterogens: 2AX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mnsA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn