PDB entry 4ml7

View 4ml7 on RCSB PDB site
Description: Crystal structure of Brucella abortus PliC in complex with human lysozyme
Class: hydrolase
Keywords: inhibitor, lysozyme, HYDROLASE
Deposited on 2013-09-06, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ml7a_
  • Chain 'B':
    Compound: Humanlysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ML7 (Start-98)
  • Chain 'C':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ml7c_
  • Chain 'D':
    Compound: Humanlysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ML7 (Start-98)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ml7A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ml7A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ml7C (C:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'D':
    No sequence available.