PDB entry 4mit

View 4mit on RCSB PDB site
Description: Crystal structure of E. histolytica RacC bound to the EhPAK4 PBD
Class: signaling protein
Keywords: G domain, p21 binding domain, CRIB motif, hydrolase, signaling protein, kinase, GTP binding
Deposited on 2013-09-02, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.178
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho family GTPase
    Species: Entamoeba histolytica [TaxId:885315]
    Gene: EhRacC, KM1_331620
    Database cross-references and differences (RAF-indexed):
    • Uniprot M7WE85
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4mita_
  • Chain 'B':
    Compound: Rho family GTPase
    Species: Entamoeba histolytica [TaxId:885315]
    Gene: EhRacC, KM1_331620
    Database cross-references and differences (RAF-indexed):
    • Uniprot M7WE85 (Start-185)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4mitb_
  • Chain 'C':
    Compound: Rho family GTPase
    Species: Entamoeba histolytica [TaxId:885315]
    Gene: EhRacC, KM1_331620
    Database cross-references and differences (RAF-indexed):
    • Uniprot M7WE85 (Start-185)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4mitc_
  • Chain 'D':
    Compound: Rho family GTPase
    Species: Entamoeba histolytica [TaxId:885315]
    Gene: EhRacC, KM1_331620
    Database cross-references and differences (RAF-indexed):
    • Uniprot M7WE85 (Start-185)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4mitd_
  • Chain 'E':
    Compound: Serine/threonine protein kinase PAK, putative
    Species: Entamoeba histolytica [TaxId:885318]
    Gene: EHI7A_018700, EhPAK4
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Serine/threonine protein kinase PAK, putative
    Species: Entamoeba histolytica [TaxId:885318]
    Gene: EHI7A_018700, EhPAK4
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Serine/threonine protein kinase PAK, putative
    Species: Entamoeba histolytica [TaxId:885318]
    Gene: EHI7A_018700, EhPAK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot N9UZ59 (3-End)
      • expression tag (0-2)
  • Chain 'H':
    Compound: Serine/threonine protein kinase PAK, putative
    Species: Entamoeba histolytica [TaxId:885318]
    Gene: EHI7A_018700, EhPAK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot N9UZ59 (3-End)
      • expression tag (1-2)
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mitA (A:)
    snamsekptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiql
    alwdtagleeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilv
    gtkldtrndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeav
    ktvlmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mitA (A:)
    ptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiqlalwdtag
    leeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilvgtkldtr
    ndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeavktvlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mitB (B:)
    snamsekptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiql
    alwdtagleeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilv
    gtkldtrndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeav
    ktvlmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mitB (B:)
    ptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiqlalwdtag
    leeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilvgtkldtr
    ndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeavktvlmn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mitC (C:)
    snamsekptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiql
    alwdtagleeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilv
    gtkldtrndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeav
    ktvlmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mitC (C:)
    ekptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiqlalwdt
    agleeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilvgtkld
    trndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeavktvlm
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mitD (D:)
    snamsekptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiql
    alwdtagleeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilv
    gtkldtrndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeav
    ktvlmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mitD (D:)
    ekptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiqlalwdt
    agleeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilvgtkld
    trndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeavktvlm
    n
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.