PDB entry 4mij

View 4mij on RCSB PDB site
Description: Crystal structure of a Trap periplasmic solute binding protein from Polaromonas sp. JS666 (Bpro_3107), target EFI-510173, with bound alpha/beta D-Galacturonate, space group P21
Class: transport protein
Keywords: TRAP PERIPLASMIC SOLUTE BINDING FAMILY, ENZYME FUNCTION INITIATIVE, EFI, Structural Genomics, TRANSPORT PROTEIN
Deposited on 2013-08-31, released 2013-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRAP dicarboxylate transporter, DctP subunit
    Species: Polaromonas [TaxId:296591]
    Gene: Bpro_3107
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q128M1 (Start-329)
      • expression tag (330-331)
    Domains in SCOPe 2.07: d4mija1, d4mija2
  • Heterogens: CL, EDO, GTR, ADA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mijA (A:)
    mtnrtprisairsaalaallaglgmgaaqatefrsadthnaddyptvaavkymgellekk
    sggkhkikvfnkqalgseketidqvkigaldftrvnvgpmnaicpltqvptmpflfssia
    hmrksldgpvgdeilkscesagfiglafydsgarsiyakkpirtvadakglkirvqqsdl
    wvalvsamganatpmpygevytglktglidaaennipsfdtakhveavkvysktehsmap
    eilvmskiiydklpkaeqdmiraaakesvaferqkwdeqeakslanvkaagaeivevdkk
    sfqavmgpvydkfmttpdmkrlvkavqdtkaenlyfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mijA (A:)
    tefrsadthnaddyptvaavkymgellekksggkhkikvfnkqalgseketidqvkigal
    dftrvnvgpmnaicpltqvptmpflfssiahmrksldgpvgdeilkscesagfiglafyd
    sgarsiyakkpirtvadakglkirvqqsdlwvalvsamganatpmpygevytglktglid
    aaennipsfdtakhveavkvysktehsmapeilvmskiiydklpkaeqdmiraaakesva
    ferqkwdeqeakslanvkaagaeivevdkksfqavmgpvydkfmttpdmkrlvkavqdtk
    ae