PDB entry 4mh4

View 4mh4 on RCSB PDB site
Description: Crystal Structure of OsmC-like protein from Burkholderia cenocepacia J2315
Class: protein binding
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OsmC-like protein, peroxiredoxin, PROTEIN BINDING
Deposited on 2013-08-29, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OsmC-like protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_17290, BCAL1766
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mh4a_
  • Chain 'B':
    Compound: OsmC-like protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_17290, BCAL1766
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mh4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mh4A (A:)
    mahhhhhhmskiekvlytgkthttsggrdgaarssdgrldiqlsspgsagtgtnpeqlfa
    agwsacfigamqlaaraakvtlpadlavdaevdlgtagnayflqarlnvsvpglerdvaq
    rivdaahqtcpyskatrgnidvdiria
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mh4A (A:)
    skiekvlytgkthttsggrdgaarssdgrldiqlsspgsagtgtnpeqlfaagwsacfig
    amqlaaraakvtlpadlavdaevdlgtagnayflqarlnvsvpglerdvaqrivdaahqt
    cpyskatrgnidvdiria
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mh4B (B:)
    mahhhhhhmskiekvlytgkthttsggrdgaarssdgrldiqlsspgsagtgtnpeqlfa
    agwsacfigamqlaaraakvtlpadlavdaevdlgtagnayflqarlnvsvpglerdvaq
    rivdaahqtcpyskatrgnidvdiria
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mh4B (B:)
    kiekvlytgkthttsggrdgaarssdgrldiqlsspgsagtgtnpeqlfaagwsacfiga
    mqlaaraakvtlpadlavdaevdlgtagnayflqarlnvsvpglerdvaqrivdaahqtc
    pyskatrgnidvdiria