PDB entry 4mh0

View 4mh0 on RCSB PDB site
Description: Selective activation of Epac1 and Epac2
Class: signaling protein/GTP-binding protein
Keywords: Guanine Nucleotide Exchange Factor, Nucleotide Binding, SIGNALING PROTEIN-GTP-BINDING PROTEIN complex
Deposited on 2013-08-29, released 2014-09-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.266
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: rap guanine nucleotide exchange factor 4
    Species: Mus musculus [TaxId:10090]
    Gene: Rapgef4, Cgef2, Epac2
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mh0r_
  • Heterogens: HR4, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4mh0R (R:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mh0R (R:)
    eyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvqcmleildtagteqftam
    rdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdledervvg
    keqgqnlaflessakskinvneifydlvrq