PDB entry 4mgg

View 4mgg on RCSB PDB site
Description: Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121
Class: isomerase
Keywords: Enolase, NYSGRC, Structural Genomics, New York Structural Genomics Research Consortium, ISOMERASE
Deposited on 2013-08-28, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.154
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0NXQ8 (2-368)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4mgga1, d4mgga2, d4mgga3
  • Chain 'B':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mggb1, d4mggb2
  • Chain 'C':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mggc1, d4mggc2
  • Chain 'D':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0NXQ8 (2-368)
      • expression tag (1)
    Domains in SCOPe 2.07: d4mggd1, d4mggd2, d4mggd3
  • Chain 'E':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0NXQ8 (2-368)
      • expression tag (1)
    Domains in SCOPe 2.07: d4mgge1, d4mgge2, d4mgge3
  • Chain 'F':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0NXQ8 (2-368)
      • expression tag (1)
    Domains in SCOPe 2.07: d4mggf1, d4mggf2, d4mggf3
  • Chain 'G':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mggg1, d4mggg2
  • Chain 'H':
    Compound: muconate lactonizing enzyme
    Species: Labrenzia aggregata [TaxId:384765]
    Gene: SIAM614_28497
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0NXQ8 (2-368)
      • expression tag (1)
    Domains in SCOPe 2.07: d4mggh1, d4mggh2, d4mggh3
  • Heterogens: CL, NI, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mggA (A:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mggB (B:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mggB (B:)
    mkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplsyalgvr
    sglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytllg
    gaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkk
    sdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidg
    pntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiah
    larstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvary
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mggC (C:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mggC (C:)
    mkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsaylps
    yalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqp
    lytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihat
    rsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvl
    devidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdiv
    taaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlg
    epvarys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mggD (D:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mggD (D:)
    hmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplyalgvr
    sglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytllg
    gaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkk
    sdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidg
    pntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiah
    larstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvary
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4mggE (E:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mggE (E:)
    hmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplyalgvr
    sglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytllg
    gaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkk
    sdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidg
    pntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiah
    larstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvary
    s
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4mggF (F:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mggF (F:)
    hmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplsyalgv
    rsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytll
    ggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlk
    ksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevid
    gpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaia
    hlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvar
    ys
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4mggG (G:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mggG (G:)
    mkitainvfqvdlplreevfdstvveietdeglkgyaeccplgsyalgvrsglqelaphl
    igkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytllggaaqddvaly
    raisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkksdllvadant
    gwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidgpntlvrgiae
    damdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiahlarstpseft
    fsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvarys
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4mggH (H:)
    shmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsayl
    psyalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatg
    qplytllggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrih
    atrsvlkksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpf
    vldevidgpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggd
    ivtaaiahlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdv
    lgepvarys
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mggH (H:)
    hmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplsyalgv
    rsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytll
    ggaaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlk
    ksdllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevid
    gpntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaia
    hlarstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvar
    ys