PDB entry 4mf4

View 4mf4 on RCSB PDB site
Description: Crystal structure of a HpcH/Hpal aldolase/citrate lyase family protein from Burkholderia cenocepacia J2315
Class: lyase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, aldolase, citrate lyase, LYASE
Deposited on 2013-08-27, released 2013-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HpcH/HpaI aldolase/citrate lyase family protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_04740, BCAL0476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mf4a_
  • Chain 'B':
    Compound: HpcH/HpaI aldolase/citrate lyase family protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_04740, BCAL0476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mf4b_
  • Chain 'C':
    Compound: HpcH/HpaI aldolase/citrate lyase family protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_04740, BCAL0476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mf4c_
  • Chain 'D':
    Compound: HpcH/HpaI aldolase/citrate lyase family protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_04740, BCAL0476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mf4d_
  • Chain 'E':
    Compound: HpcH/HpaI aldolase/citrate lyase family protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_04740, BCAL0476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mf4e_
  • Chain 'F':
    Compound: HpcH/HpaI aldolase/citrate lyase family protein
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BceJ2315_04740, BCAL0476
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mf4f_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mf4A (A:)
    mahhhhhhmstltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapn
    dsrdvasqlraiaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavr
    ltrfpspespdglrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaat
    pgvdclfvgpadlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyr
    eagyrlitvsadvswllratrqalqevrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mf4A (A:)
    ltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapndsrdvasqlra
    iaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavrltrfpspespd
    glrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaatpgvdclfvgpa
    dlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyreagyrlitvsa
    dvswllratrqalqevrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mf4B (B:)
    mahhhhhhmstltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapn
    dsrdvasqlraiaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavr
    ltrfpspespdglrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaat
    pgvdclfvgpadlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyr
    eagyrlitvsadvswllratrqalqevrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mf4B (B:)
    ltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapndsrdvasqlra
    iaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavrltrfpspespd
    glrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaatpgvdclfvgpa
    dlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyreagyrlitvsa
    dvswllratrqalqevrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mf4C (C:)
    mahhhhhhmstltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapn
    dsrdvasqlraiaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavr
    ltrfpspespdglrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaat
    pgvdclfvgpadlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyr
    eagyrlitvsadvswllratrqalqevrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mf4C (C:)
    ltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapndsrdvasqlra
    iaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavrltrfpspespd
    glrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaatpgvdclfvgpa
    dlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyreagyrlitvsa
    dvswllratrqalqevrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mf4D (D:)
    mahhhhhhmstltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapn
    dsrdvasqlraiaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavr
    ltrfpspespdglrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaat
    pgvdclfvgpadlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyr
    eagyrlitvsadvswllratrqalqevrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mf4D (D:)
    ltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapndsrdvasqlra
    iaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavrltrfpspespd
    glrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaatpgvdclfvgpa
    dlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyreagyrlitvsa
    dvswllratrqalqevrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4mf4E (E:)
    mahhhhhhmstltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapn
    dsrdvasqlraiaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavr
    ltrfpspespdglrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaat
    pgvdclfvgpadlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyr
    eagyrlitvsadvswllratrqalqevrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mf4E (E:)
    tnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapndsrdvasqlrai
    aaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavrltrfpspespdg
    lrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaatpgvdclfvgpad
    laaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyreagyrlitvsad
    vswllratrqalqevrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4mf4F (F:)
    mahhhhhhmstltnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapn
    dsrdvasqlraiaaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavr
    ltrfpspespdglrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaat
    pgvdclfvgpadlaaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyr
    eagyrlitvsadvswllratrqalqevrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mf4F (F:)
    tnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapndsrdvasqlrai
    aaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavrltrfpspespdg
    lrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaatpgvdclfvgpad
    laaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyreagyrlitvsad
    vswllratrqalqevrs