PDB entry 4mez

View 4mez on RCSB PDB site
Description: Crystal structure of M68L/M69T double mutant TEM-1
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2013-08-27, released 2014-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.195
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered mutation (42-43)
    Domains in SCOPe 2.04: d4meza_
  • Chain 'B':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered mutation (42-43)
  • Heterogens: CL, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4mezA (A:)
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

  • Chain 'B':
    No sequence available.