PDB entry 4me6

View 4me6 on RCSB PDB site
Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP
Class: ligase
Keywords: ADP-depending enzyme, d-alanine-d-alanine ligase, Nucleotide binding, LIGASE
Deposited on 2013-08-25, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: ddlA, ddl, XOO0352
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5H614 (40-End)
      • see remark 999 (20-39)
      • engineered mutation (345)
    Domains in SCOPe 2.07: d4me6a1, d4me6a2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4me6A (A:)
    mghhhhhhhssenlyfqghmrkirvglifggksaehevslqsarnildaldpqrfepvli
    gidkqgqwhvndpdsfllhaddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidv
    vfpivhgtlgedgslqgllrmanlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcf
    drhtaahadvdtliaqlglplfvkpanqgssvgvsqvrtadafaaalalalaydhkvlve
    aavagreiecavlgnavphasvcgevvvhdafysyatkyisehgaeivipadidaqtqqr
    iqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasgldyrg
    litrlielalerhtddqllrsavelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4me6A (A:)
    rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
    ddparialhrsgrgvallpgaqqqqlrpiqaqidvvfpivhgtlgedgslqgllrmanlp
    fvgsgvlgsavamdkdmakrvlrdarlavapfvcfdrhtahadvdtliaqlglplfvkpa
    nqvgvsqvrtadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvei
    vipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvy
    pklwqasgldyrglitrlielalerhtddqllrsave