PDB entry 4mdp

View 4mdp on RCSB PDB site
Description: Crystal structure of a GH1 beta-glucosidase from the fungus Humicola insolens in complex with glucose
Class: Hydrolase
Keywords: Glycoside Hydrolase Family 1, TIM barrel, retaining enzyme, Hydrolase
Deposited on 2013-08-23, released 2014-06-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Humicola grisea var. thermoidea [TaxId:5528]
    Gene: bgl4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93784 (23-498)
      • expression tag (22)
    Domains in SCOPe 2.06: d4mdpa1, d4mdpa2
  • Heterogens: BGC, PEG, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mdpA (A:)
    mgsshhhhhhssglvprgshmasmslppdfkwgfataayqiegsvnedgrgpsiwdtfca
    ipgkiadgssgavacdsykrtkediallkelgansyrfsiswsriiplggrndpinqkgi
    dhyvkfvddlieagitpfitlfhwdlpdaldkryggflnkeefaadfenyarimfkaipk
    ckhwitfnepwcsailgyntgyfapghtsdrskspvgdsarepwivghniliaharavka
    yredfkptqggeigitlngdatlpwdpedpadieacdrkiefaiswfadpiyfgkypdsm
    rkqlgdrlpeftpeevalvkgsndfygmnhytanyikhktgvppeddflgnletlfynky
    gdcigpetqsfwlrphaqgfrdllnwlskrygypkiyvtengtslkgendmpleqvledd
    frvkyfndyvramaaavaedgcnvrgylawslldnfewaegyetrfgvtyvdyandqkry
    pkksakslkplfdslirke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mdpA (A:)
    smslppdfkwgfataayqiegsvnedgrgpsiwdtfcaipgkiadgssgavacdsykrtk
    ediallkelgansyrfsiswsriiplggrndpinqkgidhyvkfvddlieagitpfitlf
    hwdlpdaldkryggflnkeefaadfenyarimfkaipkckhwitfnepwcsailgyntgy
    fapghtsdrskspvgdsarepwivghniliaharavkayredfkptqggeigitlngdat
    lpwdpedpadieacdrkiefaiswfadpiyfgkypdsmrkqlgdrlpeftpeevalvkgs
    ndfygmnhytanyikhktgvppeddflgnletlfynkygdcigpetqsfwlrphaqgfrd
    llnwlskrygypkiyvtengtslkgendmpleqvleddfrvkyfndyvramaaavaedgc
    nvrgylawslldnfewaegyetrfgvtyvdyandqkrypkksakslkplfdslirke