PDB entry 4mdh

View 4mdh on RCSB PDB site
Description: refined crystal structure of cytoplasmic malate dehydrogenase at 2.5- angstroms resolution
Deposited on 1989-04-12, released 1989-04-19
The last revision prior to the SCOP 1.67 freeze date was dated 1992-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.167
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mdhA (A:)
    sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
    lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
    ksvkvivvgnpantncltasksapsipkenfscltrldhnrakaqialklgvtsddvknv
    iiwgnhsstqypdvnhakvklqakevgvyeavkddswlkgefittvqqrgaavikarkls
    samsaakaicdhvrdiwfgtpegefvsmgiisdgnsygvpddllysfpvtikdktwkive
    glpindfsrekmdltakelaeeketafeflssa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mdhB (B:)
    sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
    lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
    ksvkvivvgnpantncltasksapsipkenfscltrldhnrakaqialklgvtsddvknv
    iiwgnhsstqypdvnhakvklqakevgvyeavkddswlkgefittvqqrgaavikarkls
    samsaakaicdhvrdiwfgtpegefvsmgiisdgnsygvpddllysfpvtikdktwkive
    glpindfsrekmdltakelaeeketafeflssa