PDB entry 4md6

View 4md6 on RCSB PDB site
Description: Crystal structure of PDE5 in complex with inhibitor 5R
Class: hydrolase/hydrolase inhibitor
Keywords: protein-inhibitor complex, phosphodiesterase, PDE5 inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-08-22, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md6a_
  • Heterogens: SO4, 24E, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4md6A (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md6A (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqchsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatd
    lalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvat
    effdqgekknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq