PDB entry 4mcv

View 4mcv on RCSB PDB site
Description: Star 12 bound to analog-sensitive Src kinase
Class: transferase/transferase inhibitor
Keywords: Kinase Domain, Tyrosine Kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-08-21, released 2013-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.243
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (0-277)
      • engineered mutation (82)
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-277)
      • engineered mutation (82)
    Domains in SCOPe 2.03: d4mcvb_
  • Heterogens: 29K

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mcvB (B:)
    akdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmk
    klrheklvqlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgma
    yvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaal
    ygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlm
    cqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mcvB (B:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkptmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglarlikfpikwtapeaalygrftiksdvwsf
    gilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerpt
    feylqafledyftstepqyqpgenl