PDB entry 4may

View 4may on RCSB PDB site
Description: Crystal structure of an immune complex
Class: immune system
Keywords: immune complex, autoimmunity, multiple sclerosis, antigen presentation, IMMUNE SYSTEM
Deposited on 2013-08-18, released 2013-10-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQ1 alpha chain, HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4maya1, d4maya2
  • Chain 'B':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, HLA-DQ1 beta chain, HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4mayb1, d4mayb2
  • Chain 'C':
    Compound: HY.1B11 TCR alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MAY
    Domains in SCOPe 2.04: d4mayc1, d4mayc2
  • Chain 'D':
    Compound: UL15 peptide-HY.1B11 TCR beta chain, chimeric construct
    Species: unidentified herpesvirus, homo sapiens [TaxId:39059, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MAY
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mayA (A:)
    divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
    alrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkhw
    epe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mayA (A:)
    ivadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqga
    lrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvvni
    twlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkhwe
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mayB (B:)
    egrdspedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpva
    eywnsqkevlegarasvdrvcrhnyevayrgilqrrveptvtispsrtealnhhnllics
    vtdfypsqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehp
    slqspitvewraqsesaqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mayB (B:)
    spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn
    sqkevlegarasvdrvcrhnyevayrgilqrrveptvtispsnllicsvtdfypsqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    q
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mayC (C:)
    mkgenveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekk
    dqriavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipniqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffpspesss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mayC (C:)
    enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr
    iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnns
    

  • Chain 'D':
    No sequence available.