PDB entry 4max

View 4max on RCSB PDB site
Description: Crystal structure of Synechococcus sp. PCC 7002 globin at cryogenic temperature with heme modification
Class: unknown function
Keywords: hemeprotein, 2/2 hemoglobin, glbN, trhbN, 2/2 globin, ROS/RNS detoxification, UNKNOWN FUNCTION
Deposited on 2013-08-18, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.174
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4maxa_
  • Chain 'B':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4maxb_
  • Chain 'C':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4maxc_
  • Heterogens: HEB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4maxA (A:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4maxB (B:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4maxC (C:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr