PDB entry 4map

View 4map on RCSB PDB site
Description: Crystal structure of Ara h 8 purified with heating
Class: plant protein
Keywords: Bet v 1 like, small molecule carrier, PLANT PROTEIN
Deposited on 2013-08-16, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mapa_
  • Chain 'B':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mapb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mapA (A:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mapA (A:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mapB (B:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mapB (B:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy